PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.002G230200.1
Common NamePHAVU_002G230200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family Dof
Protein Properties Length: 348aa    MW: 37110.1 Da    PI: 8.9542
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.002G230200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-3945105262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  Phvul.002G230200.1  45 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 105
                         7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.5E-3447103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52549103IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-2650103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MVVVTPPTAS NKWTQLSSLA SQIDDRKASM GRVMEKPTQD LLQQQQQALK CPRCDSSNTK  60
FCYYNNYSLS QPRHFCKACK RYWTRGGTLR NVPVGGGCRK NKRVKRPNGD ASANSPPSSS  120
TPSSNSNPPS RPHIPSSSTA NHVNVNPLFY GLPNSNGCDV MDVPFPRFNL QSQLNALGLG  180
FSSGVNVISS EPSDNGFSTT TTTSNTNNFL SAYNSIFGSS SSSTCAPSTP VMASLLSSTL  240
LQQKFIGGAG VKGHHDGNGF QGFAPLQGLQ MEGSNNISSK EVKAEGPNRL ELEWSNNNNN  300
NGGGGACQNQ MEHVGLSDPN SLYWNTATGL SAWSDQPNFG PSVTSLI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150340.0AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007159343.10.0hypothetical protein PHAVU_002G230200g
TrEMBLV7CMB70.0V7CMB7_PHAVU; Uncharacterized protein
STRINGGLYMA07G31870.21e-135(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.17e-36Dof family protein